TREH, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TREH, Each
$ 1,069.20
|
|
Details:
This gene encodes an enzyme that hydrolyses trehalose, a disaccharide formed from two glucose molecules found mainly in fungi, plants, and insects. A partial duplication of this gene is located adjacent to this locus on chromosome 11. [provided by RefSeqSequence: LYQDDKQFVDMPLSIAPEQVLQTFTELSRDHNHSIPREQLQAFVHEHFQAKGQELQPWTPADWKDSPQFLQKISDAKLRAWAGQLHQLWKKLGKK
Additional Information
| SKU | 10289378 |
|---|---|
| UOM | Each |
| UNSPSC | 12161500 |
| Manufacturer Part Number | PAB23459 |
| CAS Number | 64-17-5 |
| HS Code | 2207100000 |
|---|---|
| UN Number | UN 1170 |
| Proper Shipping Name | Ethanol |
| Packaging Group | PG II |
| Commodity Code | 526, 527 |
| DG or HZ | DG |
| Hazardous Class | 3 |
| Label | ![]() |
| Molecular Formula | C2H6O |
| EC Number | 200-578-6 |
| HIN | 33 |
| Hazard Statement | H225-H319 |
| Precautionary Statements | P280a-P303+P361+P353-P405-P501a-P210-P280-P305+P351+P338-P337+P313-P403+P235-P370+P378-P308+P311-P260-P301+P310-P311 |
| Risk Statements | 11-10-36/37/38-39/23/24/25-23/24/25-68/20/21/22-20/21/22-52/53-51/53 |
| GHS | GHS02,GHS07 |
| GHS (Pictogram) | ![]() ![]() |
| Safety Statements | 16-7-36-26-45-36/37-61-24/25-2017/7/16 |
| Hazard Code | F,T,Xn,N |
| Signal Word | Danger |



