518-831-8000 sales@utechproducts.com

Trim11, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Trim11, Each

$ 1,757.70

Details

The protein encoded by this gene is a member of the tripartite motif (trim) family. The trim motif includes three zinc-binding domains, a ring, a b-box type 1 and a b-box type 2, and a coiled-coil region. This protein localizes to the nucleus and the cytoplasm. Its function has not been identified. [Provided by refseqsequence: lgqqsahlaeliaelegrcqlpalgllqdikdalrrvqdvklqppevvpmelrtvcrvpglvetlrrfrgdvtldp

Additional Information

SKU 10288275
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22174