518-831-8000 sales@utechproducts.com

Tsks, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tsks, Each

$ 1,757.70

Details

This gene may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the encoded protein is highest in the testis and down-regulated in testicular cancer. The gene is localized to the region 19q13.3 Among the related ras viral oncogene homolog (rras) and interferon regulatory factor 3 (irf3) genes, which are both involved in tumorigenesis pathways and progression. [Provided by refseqsequence: ltpacpscqrlhkkilelerqalakhvraealsstlrlaqdealraknllltdkmkpeekmatldhlhlkmcslhdhlsnlplegstgtmgggssagt

Additional Information

SKU 10292210
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28322