518-831-8000 sales@utechproducts.com

TSSC4, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TSSC4, Each

1,757.70

Details:

This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene is located among several imprinted genes; however, this gene, as well as the pan-hematopoietic expression gene (PHEMX), escapes imprinting. This gene may play a role in malignancies and disease that involve this region. [provided by RefSeqSequence: TKYSLEDVTEVSEQSNQATALAFLGSQSLAAPTDCVSSFNQDPSSCGEGRVIFTKPVRGVEARHERKRVLGKVGEPGRGGLGNPATD

Additional Information

SKU 10289739
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23855