518-831-8000 sales@utechproducts.com

TST, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TST, Each

1,069.20

Details:

The product of this gene is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The gene product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin. [provided by RefSeqSequence: RSLLKTYEQVLENLESKRFQLVDSRSQGRFLGTEPEPDAVGLDSGHIRGAVNMPFMDFLTEDGFEKGPEELRALFQTKKVDLSQPLIATCRKGVTACHVALAAYLCGKPDVAVYDGSWSEWFRRAPPESRVSQGKS

Additional Information

SKU 10292481
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28638