518-831-8000 sales@utechproducts.com

TYSND1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TYSND1, Each

1,757.70

Details:

All peroxisomal proteins are synthesized in the cytosol, and 2 distinct peroxisomal targeting signals (PTSs), the C-terminal PTS1 and N-terminal PTS2, are used for transport of these proteins into peroxisomes. Proteolytic cleavage of the N-terminal targeting sequence of PTS2 proteins accompanies import into peroxisomes, and many PTS1 proteins undergo C-terminal processing once in the peroxisomal matrix. TYSND1 processes both PTS1 and PTS2 proteins involved in beta-oxidation of fatty acids (Kurochkin et al., 2007 [PubMed 17255948]).[supplied by OMIMSequence: ATQETCPYDIAVVSLEEDLDDVPIPVPAEHFHEGEAVSVVGFGVFGQSCGPSVTSGILSAVVQVNGTPVMLQTTCAV

Additional Information

SKU 10288775
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22755