518-831-8000 sales@utechproducts.com

UBE2L3 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant UBE2L3, Each

1,069.20

Details

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NFkb precursor p105 in vitro. Several alternatively spliced transcript variants have been found for this gene. [provided by RefSeqSequence: MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFK

Additional Information

SKU 10292208
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28318