518-831-8000 sales@utechproducts.com

Ube2l3 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ube2l3, Each

$ 1,757.70

Details

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (e1s), ubiquitin-conjugating enzymes (e2s) and ubiquitin-protein ligases (e3s). This gene encodes a member of the e2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-fos, and the nfkb precursor p105 in vitro. Several alternatively spliced transcript variants have been found for this gene. [Provided by refseqsequence: maasrrlmkeleeirkcgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpaeypfk

Additional Information

SKU 10292208
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28318