UBXN4, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant UBXN4, Each
$ 1,757.70
|
|
Details:
UBXD2 is an integral membrane protein of the endoplasmic reticulum (ER) that binds valosin-containing protein (VCP; MIM 601023) and promotes ER-associated protein degradation (ERAD) (Liang et al., 2006 [PubMed 16968747]).[supplied by OMIMSequence: ERSTVARIQFRLPDGSSFTNQFPSDAPLEEARQFAAQTVGNTYGNFSLATMFPRREFTKEDYKKKLLDLELAPSASVVLLPAGRPTASIV
Additional Information
| SKU | 10288966 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22981 |
