518-831-8000 sales@utechproducts.com

Unc13a, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Unc13a, Each

$ 1,356.75

Details

Proteins of the unc13 family, such as unc13a, are diacylglycerol and phorbol ester receptors with ligand affinities similar to those of protein kinase c (see prkca; mim 176960). Rodent unc13a is a presynaptic protein with an essential role in synaptic vesicle priming (rossner et al., 2004 [Pubmed 15123597]).[Supplied by omimsequence: qlsedfdpdehslqgsdmederdrdsyhschssvsyhkdsprwdqdeeeleedledfleeee

Additional Information

SKU 10282391
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23802