UQCRB, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant UQCRB, Each

Details

This gene encodes a protein which is part of the ubiquinol-cytochrome c oxidoreductase complex which contains ten nuclear-encoded and one mitochondrial-encoded subunits. The encoded protein binds ubiquinone and participates in the transfer of electrons when ubiquinone is bound. Mutations in this gene are associated with mitochondrial complex III deficiency. A pseudogene has been described on the X chromosome. [provided by RefSeqSequence: LPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK