UQCRQ, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant UQCRQ, Each

$ 1,347.30
|
Details
This gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain. [provided by RefSeqSequence: REFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRR
Additional Information
SKU | 10290176 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB24512 |