518-831-8000 sales@utechproducts.com

USH1G, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant USH1G, Each

1,069.20

Details:

This gene encodes a protein that contains three ankyrin domains, a class I PDZ-binding motif and a sterile alpha motif. The encoded protein interacts with harmonin, which is associated with Usher syndrome type 1C. This protein plays a role in the development and maintenance of the auditory and visual systems and functions in the cohesion of hair bundles formed by inner ear sensory cells. Mutations in this gene are associated with Usher syndrome type 1G (USH1G). [provided by RefSeqSequence: NIWCLDNDYHTPLDMAAMKGHMECVRYLDSIAAKQSSLNPKLVGKLKDKAFREAERRIRECAKLQRRHHERMER

Additional Information

SKU 10287859
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21685