518-831-8000 sales@utechproducts.com

USP30, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant USP30, Each

1,054.35

Details

USP30, a member of the ubiquitin-specific protease family (see USP1, MIM 603478), is a novel mitochondrial deubiquitinating (DUB) enzyme (Nakamura and Hirose, 2008 [PubMed 18287522]).[supplied by OMIMSequence: IEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSST

Additional Information

SKU 10282378
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20915