USP36, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant USP36, Each

$ 1,101.60
|
Details
Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP36 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).[supplied by OMIMSequence: DSLVHSSNVKVVLNQQAYVLFYLRIPGSKKSPEGLISRTGSSSLPGRPSVIPDHSKKNIGNGIISSPLTGKRQDSGTMKKPHTTEEIGVPISRNGSTLGLKSQNGCIPPKLPSGSPSPKLSQTPTHMPTILDDPGKKVKKPAPP
Additional Information
SKU | 10282377 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB20583 |