518-831-8000 sales@utechproducts.com

UST, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant UST, Each

1,069.20

Details

Uronyl 2-sulfotransferase transfers sulfate to the 2-position of uronyl residues, such as iduronyl residues in dermatan sulfate and glucuronyl residues in chondroitin sulfate (Kobayashi et al., 1999 [PubMed 10187838]).[supplied by OMIMSequence: YNRVGKCGSRTVVLLLRILSEKHGFNLVTSDIHNKTRLTKNEQMELIKNISTAEQPYLFTRHVHFLNFSRFG

Additional Information

SKU 10288647
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22603