518-831-8000 sales@utechproducts.com

Uxs1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Uxs1, Each

$ 1,318.98

Details

Udp-glucuronate decarboxylase (ugd; ec 4.1.1.35) Catalyzes the formation of udp-xylose from udp-glucuronate. Udp-xylose is then used to initiate glycosaminoglycan biosynthesis on the core protein of proteoglycans.[Supplied by omimsequence: mrsiqengelkieskieemveplrekirdleksftqkyppvkflsekdrkrilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhdv

Additional Information

SKU 10286782
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20451