VILL, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant VILL, Each
$ 1,757.70
|
|
Details:
The protein encoded by this gene belongs to the villin/gelsolin family. It contains 6 gelsolin-like repeats and a headpiece domain. It may play a role in actin-bundling. [provided by RefSeqSequence: IGWFFTWDPYKWTSHPSHKEVVDGSPAAASTISEITAEVNNLRLSRWPGNGRAGAVALQALKGSQDSSENDLVRSPKSAGSRTSSSV
Additional Information
| SKU | 10288894 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22894 |
