518-831-8000 sales@utechproducts.com

VILL, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant VILL, Each

1,757.70

Details:

The protein encoded by this gene belongs to the villin/gelsolin family. It contains 6 gelsolin-like repeats and a headpiece domain. It may play a role in actin-bundling. [provided by RefSeqSequence: IGWFFTWDPYKWTSHPSHKEVVDGSPAAASTISEITAEVNNLRLSRWPGNGRAGAVALQALKGSQDSSENDLVRSPKSAGSRTSSSV

Additional Information

SKU 10288894
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22894