518-831-8000 sales@utechproducts.com

Vill, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Vill, Each

$ 1,757.70

Details

The protein encoded by this gene belongs to the villin/gelsolin family. It contains 6 gelsolin-like repeats and a headpiece domain. It may play a role in actin-bundling. [Provided by refseqsequence: igwfftwdpykwtshpshkevvdgspaaastiseitaevnnlrlsrwpgngragavalqalkgsqdssendlvrspksagsrtsssv

Additional Information

SKU 10288894
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22894