518-831-8000 sales@utechproducts.com

Wbscr17, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Wbscr17, Each

$ 1,757.70

Details

This gene encodes an n-acetylgalactosaminyltransferase, which has 97% sequence identity to the mouse protein. This gene is deleted in williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. [Provided by refseqsequence: rpiavrsgdafheirpraevanlsahsaspiqdavlkrlslledivyrqlnglskslgliegyggrgkgglpatlspaeeekakgphekygynsylse

Additional Information

SKU 10286967
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20665