518-831-8000 sales@utechproducts.com

WBSCR17, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant WBSCR17, Each

1,757.70

Details:

This gene encodes an N-acetylgalactosaminyltransferase, which has 97% sequence identity to the mouse protein. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. [provided by RefSeqSequence: RPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSE

Additional Information

SKU 10286967
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20665