518-831-8000 sales@utechproducts.com

WBSCR27, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant WBSCR27, Each

1,318.98

Details:

This gene encodes a protein belonging to ubiE/COQ5 methyltransferase family. The gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.22-q11.23. [provided by RefSeqSequence: LTTRTNSSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPSWRWYPASLPRMASSPALSTCTESG

Additional Information

SKU 10287682
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21492