WDR17, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant WDR17, Each
$ 1,069.20
|
|
Details
This gene encodes a WD repeat-containing protein. It is abundantly expressed in retina and testis. Alternatively spliced transcript variants have been found for this gene, and they encode distinct isoforms. [provided by RefSeqSequence: EDVVAFVSHRGPLFIWTISGPDSGVIVHKDAHSFLSDICMFRWHTHQKGKVVFGHIDGSLSIFHPGNKNQKHVLRPESLEGTDEEDPVTALEWDPLST
Additional Information
| SKU | 10289840 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23975 |
Loading Cart Data 