518-831-8000 sales@utechproducts.com

Wdr26, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Wdr26, Each

$ 1,757.70

Details

This gene encodes a member of the wd repeat protein family. Wd repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (gh-wd), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Two transcript variants encoding two different isoforms have been found for this gene. [Provided by refseqsequence: ndlnelkplvhsphaivrmkflllqqkyleyledgkvlealqvlrceltplkynterihvlsgylmcshaedlrakaewe

Additional Information

SKU 10288765
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22739