WDR3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant WDR3, Each
$ 1,069.20
|
|
Details:
This gene encodes a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. [provided by RefSeqSequence: AKEDQPAVPGETQGDSYFTGKKTIETVKAAERIMEAIELYREETAKMKEHKAICKAAGKEVPLPSNPILMAYGSISPSAYVLEIFKGIKSSELEESLLVLP
Additional Information
| SKU | 10288171 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22044 |
