518-831-8000 sales@utechproducts.com

Wdr3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Wdr3, Each

$ 1,757.70

Details

This gene encodes a nuclear protein containing 10 wd repeats. Wd repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the c-terminal end. Proteins belonging to the wd repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. [Provided by refseqsequence: akedqpavpgetqgdsyftgkktietvkaaerimeaielyreetakmkehkaickaagkevplpsnpilmaygsispsayvleifkgiksseleesllvlp

Additional Information

SKU 10288171
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22044