518-831-8000 sales@utechproducts.com

XKR3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant XKR3, Each

1,757.70

Details:

XKRX (MIM 300684) and XKR3 are homologs of the Kell blood group precursor XK (MIM 314850), which is a putative membrane transporter and a component of the XK/Kell complex of the Kell blood group system (Calenda et al., 2006 [PubMed 16431037]).[supplied by OMIMSequence: TIRNYHKWLKNLKQEKEETQVSITKRNTMLEREIAFSIRDNFMQQKAFK

Additional Information

SKU 10288058
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21910