518-831-8000 sales@utechproducts.com

XPO6, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant XPO6, Each

1,757.70

Details:

Exportins, such as XPO6, recruit cargo in the nucleoplasm in the presence of RAN (MIM 601179)-GTP and form ternary export complexes. These complexes are transported through nuclear pore complexes to the cytoplasm, where GTP is hydrolyzed and the export complex is disassembled.[supplied by OMIMSequence: RPSPDVKAELFELLFRTLHHNWRYFFKSTVLASVQRGIAEEQMENEPQFSAIMQAFGQSFLQPDIHLFKQNLFYLETLNTKQKLYHKK

Additional Information

SKU 10289195
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23249