518-831-8000 sales@utechproducts.com

Zc3h12a Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Zc3h12a, Each

$ 1,757.70

Details

Zc3h12a is an mcp1 (ccl2; mim 158105)-induced protein that acts as a transcriptional activator and causes cell death of cardiomyocytes, possibly via induction of genes associated with apoptosis.[Supplied by omimsequence: afppreywsepyplppptsvlqeppvqspgagrspwgragslakeqasvytklcgvfpphlveavmgrfpqlldpqqlaaeilsyksqhps

Additional Information

SKU 10288649
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22605