518-831-8000 sales@utechproducts.com

ZFP57, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ZFP57, Each

2,214.00

Details:

The protein encoded by this gene is a zinc finger protein containing a KRAB domain. Studies in mouse suggest that this protein may function as a transcriptional repressor. Mutations in this gene have been associated with transient neonatal diabetes mellitus type 1 (TNDM1)Sequence: PELITKLEQEEEQWREFVHLPNTEGLSEGKKKELREQHPSLRDEGTSDDKVFLACRGAGQCPLSAPAGTMDRTRVLQASQAGPPF

Additional Information

SKU 10290192
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24530