518-831-8000 sales@utechproducts.com

Zmiz2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Zmiz2, Each

$ 1,757.70

Details

Zmiz2 and zmiz1 (mim 607159) are members of a pias (see mim 603566)-like family of proteins that interact with nuclear hormone receptors. Zmiz2 interacts with androgen receptor (ar; mim 313700) and enhances ar-mediated transcription (huang et al., 2005 [Pubmed 16051670]).[Supplied by omimsequence: lmpsvmemiaalgpgaapfaplqppsvpapsdypgqgssflgpgtfpesfppttpstptlaeftpgpppisyqsdipsslltsekstaclpsqmapaghldpthnpgtpglhtsnl

Additional Information

SKU 10289579
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23684