ZNF235, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ZNF235, Each

$ 1,069.20
|
Details
This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein is a member of the Kruppel family of zinc finger proteins, and contains Kruppel-associated box (KRAB) A and B domains and 15 tandemly arrayed C2H2-type zinc fingers. It is an ortholog of the mouse Zfp93 protein. This gene is located in a cluster of zinc finger genes on 19q13.2. [provided by RefSeqSequence: ASVDDNCLVNHIGDHSSIIENQEFPTGKVPNSWSKIYLNETQNYQRSCKQTQMKNKLCIFAPYVDIFSCISHHH
Additional Information
SKU | 10290102 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB24428 |