ZFP112 Recombinant Protein Antigen, Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition, Each

Details:

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF285. Source: E.coli Amino Acid Sequence: EREEKLLMVETETPRDGCSGRKNQQKMESIQEVTVSYFSPKELSSRQTWQQSAGGLIRCQDFLKVFQGKNSQLQEQGNSLGQVWAGIPVQISEDKNYIFTHIGNGSNYIKSQGYPSWRAHHSWRKMYLKESHNYQCRCQQI The ZNF285A Recombinant Protein Antigen is derived from E. coli. The ZNF285A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.This is a blocking peptide for NBP1-80605. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.