518-831-8000 sales@utechproducts.com

ZNF384, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ZNF384, Each

1,069.20

Details

This gene contains long CAG trinucleotide repeats coding consecutive glutamine residues. The gene product may functions as a transcription factor, with a potential role in the regulation of neurodevelopment or neuroplasticity. The protein appears to bind and regulate the promoters of MMP1, MMP3, MMP7 and COL1A1. Studies in mouse suggest that nuclear matrix transcription factors (NP/NMP4) may be part of a general mechanical pathway that couples cell construction and function during extracellular matrix remodeling. Multiple transcript variants encoding several isoforms have been found for this gene. [provided by RefSeqSequence: SHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKSDQLTPHSQASVTQNITVVPVPSTGLMTA

Additional Information

SKU 10286612
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20255